PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000436.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 351aa    MW: 39334.8 Da    PI: 7.1186
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000436.1_g00007.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.62.5e-5391371128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPtdeel+++yLk+kv+ +k+el +vi+e+d++k+ePwdL++++k     +++wyfFs++d+ky+tg+r+nrat++g+W
  Itr_sc000436.1_g00007.1   9 VPPGFRFHPTDEELLHYYLKRKVSYQKFEL-DVIREIDLNKIEPWDLQERCKIgstPQNDWYFFSHKDRKYPTGSRTNRATNAGFW 93 
                              69****************************.9***************964444222455*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+dk + + + +++g++ktLvfy+grap+g+ktdW+mheyrl
  Itr_sc000436.1_g00007.1  94 KATGRDKCIRN-SFQKIGMRKTLVFYRGRAPHGQKTDWIMHEYRL 137
                              **********9.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-606160IPR003441NAC domain
PROSITE profilePS5100557.8929160IPR003441NAC domain
PfamPF023652.3E-2810137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MASSSSGGVP PGFRFHPTDE ELLHYYLKRK VSYQKFELDV IREIDLNKIE PWDLQERCKI  60
GSTPQNDWYF FSHKDRKYPT GSRTNRATNA GFWKATGRDK CIRNSFQKIG MRKTLVFYRG  120
RAPHGQKTDW IMHEYRLDDA DDPQANPNED GWVVCRVFKK KNLFKVGSES GGSAISDQLN  180
TTAANQSRAA AAAGFSLRDT APYLLQPPHG HGGFNYSHHI PLPHHYHQLE PQNFIPGAAH  240
FSDHHAAAPI MVKQLMSDPT RDCESGSDQN LCYQPATAAC DSGLEVGSCE PPPPPQSMSE  300
WGMLVSSQMG QDDHGSSKDT RVGFEDANGS SMNHINPLSL RSEMDFWGYG K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-52916217167NO APICAL MERISTEM PROTEIN
1ut4_B1e-52916217167NO APICAL MERISTEM PROTEIN
1ut7_A1e-52916217167NO APICAL MERISTEM PROTEIN
1ut7_B1e-52916217167NO APICAL MERISTEM PROTEIN
4dul_A1e-52916217167NAC domain-containing protein 19
4dul_B1e-52916217167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002264688.11e-156PREDICTED: protein BEARSKIN1
SwissprotQ9SV871e-141BRN2_ARATH; Protein BEARSKIN2
TrEMBLF6GVX31e-156F6GVX3_VITVI; Putative uncharacterized protein
STRINGVIT_18s0089g01120.t011e-156(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-138NAC domain containing protein 70